Products

Recombinant Human IL-18BP (IL-18 Binding Protein)

Interleukin-18 binding protein (IL-18BP) is a secreted glycoprotein recognized for its pivotal role in immune regulation. By binding to the proinflammatory cytokine IL-18, IL-18BP effectively inhibits its activity, thus modulating T-helper type 1 immune responses. Notably, IL-18BP lacks a transmembrane domain and exhibits constitutive expression across various tissues. Its heightened presence in the intestinal tissues of individuals with Crohn's disease underscores its potential significance in inflammatory conditions.
No. Size Price Qty Status
C01201-5UG 5 ug $92.00 Inquiry
C01201-20UG 20 ug $160.00 Inquiry
C01201-100UG 100 ug $320.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence:
MTMRHNWTPDLSPLWVLLLCAHVVTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVA
CSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPP
TQEALPSSHSSPQQQG with polyhistidine tag at the C-terminus

UnitProt ID:
O95998

Source:
HEK293

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Purity:
>95% as determined by SDS-PAGE. 

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H₂O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 months under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for Recombinant Human IL-18BP (IL-18 Binding Protein)

Average Rating: 0 (0 Reviews )